DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT1G50060

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_175428.1 Gene:AT1G50060 / 841430 AraportID:AT1G50060 Length:161 Species:Arabidopsis thaliana


Alignment Length:136 Identity:48/136 - (35%)
Similarity:68/136 - (50%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 YRRLHNANPLKM-------DEKLCSYAQEWAD-HLADLNKLETRPNPLYGENIMRVRRSKFSVDQ 212
            |...||....::       |..|.:||..::: ..||.|.:.:  |..||||:.:...|.||...
plant    30 YLNSHNTARAQVGVPNVVWDTTLAAYALNYSNFRKADCNLVHS--NGPYGENLAKGSSSSFSAIS 92

  Fly   213 ILKLWYQEKYNYDYLKPGFNLYTG-----HFTQLVWRESEFLGVG-VACDVSSIWIV-CNYHPPG 270
            .:|||..||..|.|   .:|..||     |:||:|||:|..:|.. |.| .::.|.| |||:.||
plant    93 AVKLWVDEKPYYSY---AYNNCTGGKQCLHYTQVVWRDSVKIGCARVQC-TNTWWFVSCNYNSPG 153

  Fly   271 N-VSEH 275
            | |.|:
plant   154 NWVGEY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 46/131 (35%)
AT1G50060NP_175428.1 CAP_PR-1 27..161 CDD:349400 48/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.