DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT1G50050

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:156 Identity:43/156 - (27%)
Similarity:63/156 - (40%) Gaps:33/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YKIPIIRRKPIKQAVLRETN------KYRRLHN--------ANPLKMDEKLCSYAQEWADHLADL 185
            :|.|.:....|...|| .||      .|...||        || :..|..:.:||..:    |:.
plant     4 FKTPFLIIVAISFLVL-ATNAQNAQQDYLNTHNTARAQVGVAN-VVWDTVVAAYATNY----ANA 62

  Fly   186 NKLETRPNP----LYGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKPGFNLYTG-----HFTQL 241
            .|::....|    .||||:.....:.|:....:.||..||..|:|..   |...|     |:||:
plant    63 RKVDCSLTPSTGGSYGENLANGNNALFTGVAAVNLWVNEKPYYNYTA---NACIGAQQCKHYTQV 124

  Fly   242 VWRESEFLGVG-VACDVSSIWIVCNY 266
            ||..|..:|.. |.|:....::.|||
plant   125 VWSNSVKIGCARVLCNNGGYFVGCNY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 40/145 (28%)
AT1G50050NP_175427.1 SCP 27..151 CDD:294090 36/132 (27%)
Radical_SAM <155..185 CDD:302752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.