DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT5G66590

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:131 Identity:40/131 - (30%)
Similarity:59/131 - (45%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 NKYRRLHNANPLKMDEKLCSYAQEWADH--------LADLNKLETRPNPLYGENIMRVRRSKFSV 210
            ||.|.:....||...:.|.:.|...|.:        .|.||..:...|.|:.:.::.|..|    
plant    54 NKARAMVGVPPLVWSQTLEAAASRLARYQRNQKKCEFASLNPGKYGANQLWAKGLVAVTPS---- 114

  Fly   211 DQILKLWYQEK--YNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVA-C-DVSSIWIVCNYHPPGN 271
             ..::.|.:||  |||.......|...|.:.|:|||.|:.||...| | ..|::..:|.|:||||
plant   115 -LAVETWVKEKPFYNYKSDTCAANHTCGVYKQVVWRNSKELGCAQATCTKESTVLTICFYNPPGN 178

  Fly   272 V 272
            |
plant   179 V 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 38/129 (29%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 40/131 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.