DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT5G57625

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_680450.1 Gene:AT5G57625 / 835867 AraportID:AT5G57625 Length:207 Species:Arabidopsis thaliana


Alignment Length:145 Identity:47/145 - (32%)
Similarity:68/145 - (46%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 IYKIPIIRRKP---IKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPL 195
            :|:.|.....|   |.:..|...|..|......||..|.||.|||..||:.......|.....| 
plant    57 VYRPPTTPSLPAGSIARLFLDPHNALRSGLGLPPLIWDGKLASYATWWANQRRYDCSLTHSTGP- 120

  Fly   196 YGENIMRVRRSKFSVDQILKLWYQE--KYNYDYLKPGFNLYTGHFTQLVWRESEFLGVG-VACD- 256
            ||||:.....|.::....::.|..|  .||::......:...||:||:|||:::.||.. |.|: 
plant   121 YGENLFWGSGSSWAPGFAVQSWIVEGRSYNHNTNSCDGSGMCGHYTQMVWRDTKRLGCARVVCEN 185

  Fly   257 VSSIWIVCNYHPPGN 271
            .:.::|.|||.||||
plant   186 GAGVFITCNYDPPGN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 43/130 (33%)
AT5G57625NP_680450.1 CAP_PR-1 72..207 CDD:349400 43/130 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.