DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT5G02730

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:149 Identity:49/149 - (32%)
Similarity:71/149 - (47%) Gaps:26/149 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KQAVLRETNKYRR---------LHN-------ANPLKMDEKLCSYAQEWADHLADLNKLETRPNP 194
            |.|..|.||:.||         .||       |:.|:.|:.|..:|.:||.......|:.....|
plant    41 KAAAARATNRGRRNKQSAEFLLAHNAARVASGASNLRWDQGLARFASKWAKQRKSDCKMTHSGGP 105

  Fly   195 LYGENIMRVRRSK-FSVDQILKLWYQEKYNYDYL----KPGFNLYTGHFTQLVWRESEFLGVGVA 254
             |||||.|.:||: :|..:::..|..|..|||.:    |.|  ...||:||:|||.:..:|...:
plant   106 -YGENIFRYQRSENWSPRRVVDKWMDESLNYDRVANTCKSG--AMCGHYTQIVWRTTTAVGCARS 167

  Fly   255 -CDVS-SIWIVCNYHPPGN 271
             ||.: ...::|.|.|.||
plant   168 KCDNNRGFLVICEYSPSGN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 49/149 (33%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.