DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT4G33730

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:132 Identity:49/132 - (37%)
Similarity:65/132 - (49%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 NKYRRLHNA-------NPLKMDEKLCSYAQEWADHLAD-LNKLETRPNPLYGENIMRVRRSKFSV 210
            :.|.|.|||       .||:.|..:.:.||::|:|||. ...||....| |||| :.......|.
plant    40 DSYLRPHNAARAAVKVKPLRWDFGIATVAQDYANHLASGPCSLEHSSGP-YGEN-LAFGSGDMSA 102

  Fly   211 DQILKLWYQEKYNYDYLK-----PGFNLYTGHFTQLVWRESEFLGVGVA-CDVSSIWIVCNYHPP 269
            .|.:.:|..||..||:..     |.    .||:||:|||.|..||.|.| |:..:..:||||.|.
plant   103 AQAVAMWVHEKSYYDFYSNSCHGPA----CGHYTQVVWRGSARLGCGKAKCNNGASIVVCNYDPA 163

  Fly   270 GN 271
            ||
plant   164 GN 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 49/132 (37%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 49/132 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.