DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT4G31470

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:196 Identity:54/196 - (27%)
Similarity:78/196 - (39%) Gaps:37/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 STPNRSLNTEKDWSHGKRCLQCAAPKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIK 146
            |||..||:.:             .|..:|.:.|::   ...:||             .:.|..|:
plant    16 STPLPSLSFQ-------------IPSNRTPTTSTL---IFSQDK-------------ALARNTIQ 51

  Fly   147 QAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFSVD 211
            |..||..|..|......|||....|..||..||.......||.....| ||||:.......::..
plant    52 QQFLRPHNILRAKLRLPPLKWSNSLALYASRWARTRRGDCKLIHSGGP-YGENLFWGSGKGWTPR 115

  Fly   212 QILKLWYQEKYNYD----YLKPGFNLYTGHFTQLVWRESEFLGVGVA-CDVSSIWIVCNYHPPGN 271
            ..:..|..|...||    :.|...:..  |:|||||::|..:|..:: |.....:|:|||.||||
plant   116 DAVAAWASEMKYYDRRTSHCKANGDCL--HYTQLVWKKSSRIGCAISFCKTGDTFIICNYDPPGN 178

  Fly   272 V 272
            :
plant   179 I 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 41/130 (32%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 42/132 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101367
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.