DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT3G19690

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:155 Identity:47/155 - (30%)
Similarity:74/155 - (47%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SLLKEFEIYKIPII-----RRKPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLN 186
            ||||...::.:.|.     ..:.::|..|...|:.|.....:||..|:::.:||..:|:...:..
plant     2 SLLKTNILFLLAIALFYGSLAEDLQQQFLEAHNEARNEVGLDPLVWDDEVAAYAASYANQRINDC 66

  Fly   187 KLETRPNPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKPGFNLYTG----HFTQLVWRESE 247
            .| ...|..:|||| .:...:.|.:...::|..||..|||.....|...|    |:||:||:.:.
plant    67 AL-VHSNGPFGENI-AMSSGEMSAEDAAEMWINEKQYYDYDSNTCNDPNGGTCLHYTQVVWKNTV 129

  Fly   248 FLGVG-VACDVSSIWIVCNYHPPGN 271
            .||.. |.|:....:|.|||.||||
plant   130 RLGCAKVVCNSGGTFITCNYDPPGN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 42/131 (32%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 42/131 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.