DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT2G19980

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:135 Identity:40/135 - (29%)
Similarity:62/135 - (45%) Gaps:20/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LRETNKYRRLHNANPLKM-------DEKLCSYAQEWADHLADLNKLETRPNPLYGENI------- 200
            ||..::...|..|..|.:       |:||.::||.:|:..:....::...:..|||||       
plant    24 LRSFSRMDDLQPAETLAVHNQIRAADQKLAAHAQRYANVRSQDCAMKYSTDGTYGENIAAGWVQP 88

  Fly   201 MRVRRSKFSVDQILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVG-VACDVSS-IWIV 263
            |.......:.    |.|:.||..|:|.....:...||:||:|..:|..||.| |.|..:. :|:|
plant    89 MDTMSGPIAT----KFWFTEKPYYNYATNKCSEPCGHYTQIVANQSTHLGCGTVRCFKNEYVWVV 149

  Fly   264 CNYHP 268
            |||.|
plant   150 CNYAP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 40/135 (30%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 37/124 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.