DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and AT2G19970

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_179587.1 Gene:AT2G19970 / 816516 AraportID:AT2G19970 Length:177 Species:Arabidopsis thaliana


Alignment Length:148 Identity:50/148 - (33%)
Similarity:72/148 - (48%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YKIPIIRRKPIKQAVLRET----NKYRRLHNANPLKMDEKLCSYAQEWADHLA-----DLNKLET 190
            |.:|.:|  |||....|:|    |:.|......|||.::.:.:|||::|:..|     |.:.:..
plant    22 YGLPRVR--PIKDVQPRKTLKVHNQIRAAVGVAPLKWNKTVAAYAQKFANRQAKAGVCDYSSMRH 84

  Fly   191 RPNPLYGENIMR---VRRSKFSVDQILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVG 252
            ...| |||||..   ..:.:.|.....|.|..||.|||:.........||:||:|..:|..||.|
plant    85 SDGP-YGENIAAGWVQPKDQMSGPIAAKYWLTEKPNYDHATNKCKDVCGHYTQMVANQSLSLGCG 148

  Fly   253 -VACDVSS-IWIVCNYHP 268
             ..|..:. |:|||||:|
plant   149 SFRCHENELIYIVCNYYP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 45/137 (33%)
AT2G19970NP_179587.1 CAP_PR-1 35..177 CDD:349400 44/133 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.