DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Crispld2

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:195 Identity:52/195 - (26%)
Similarity:72/195 - (36%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNK-----YRRLHNANPLKMDE 169
            |:|...:.||....:..|.::.    .||:..|    |.:|...||     |....|...:..||
Mouse    28 TTSLEKLLSKYQHAEPHSRVRR----AIPMSDR----QEILMLHNKLRGQVYPPASNMEHMTWDE 84

  Fly   170 KLCSYAQEWADHLADLNKLETRPNPL---YGENIM----RVRRSKFSVDQILKLWYQEKYNYDYL 227
            :|...|..||....    .|..|..|   .|:|:.    |.|...|.|..    ||.|..:|.|.
Mouse    85 ELERSAAAWAHRCL----WEHGPAGLLRSIGQNLAVHWGRYRSPGFHVQS----WYDEVKDYTYP 141

  Fly   228 KP-----------GFNLYTGHFTQLVWRESEFLGVGV-ACDVSSIW---------IVCNYHPPGN 271
            .|           ...:.| |:||:||..:..:|..| .|...::|         :||||.|.||
Mouse   142 YPHECTPRCRERCSGPMCT-HYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVYLVCNYSPKGN 205

  Fly   272  271
            Mouse   206  205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 44/159 (28%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 41/157 (26%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.