DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Crisp4

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:188 Identity:49/188 - (26%)
Similarity:78/188 - (41%) Gaps:52/188 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KSLLKEFEIYKIPIIRRKPIK------------------QAVLRETNKYRRLHN---ANPLKMDE 169
            |.:|..|....:|::..:|:|                  :.::...|.:||..:   .|.||:  
Mouse    47 KFILLLFVAAFVPVVTIRPLKLDRALYNKLITESQTEPQEEIVNTHNAFRRKVSPPARNMLKV-- 109

  Fly   170 KLCSYAQEWADHLA------DLNKLETR-PNPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDYL 227
            ...|.|.|.|..||      |.:.||.| ||...||| |.:.....|..:::::|:.|.   .|.
Mouse   110 SWSSAAAENARILARYCDKSDSDSLERRLPNTFCGEN-MLMEHYPSSWSKVIEIWFNES---KYF 170

  Fly   228 KPG------FNLYTGHFTQLVWRESEFLGVGVACDV--------SSIWIVCNYHPPGN 271
            |.|      .::.|.|:||:||..:..:|    |||        ::...||:|...||
Mouse   171 KYGEWPSTDDDIETDHYTQMVWASTYLVG----CDVAACRRQKAATYLYVCHYCHEGN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 44/168 (26%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.