DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Crisp3

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:148 Identity:40/148 - (27%)
Similarity:70/148 - (47%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IKQAVLRETNKYRRLHNANP-------LKMDEKLCSYAQEWADH-LADLNKLETRPNPL-YGENI 200
            :::.::.:.|:.||  ..:|       ::.|......||:||:. :.:.:.|:.|...| .|||:
  Rat    40 VQEEIINKHNQLRR--TVSPSGSDLLRVEWDHDAYVNAQKWANRCIYNHSPLQHRTTTLKCGENL 102

  Fly   201 MRVRRSKFSVDQILKLWYQEKYNYDYLKPGF-----NLYTGHFTQLVWRESEFLGVGVACDVS-- 258
            . :.....|...:::.||.|..::.:   ||     .:..||:||:|| .|.||   |||.|:  
  Rat   103 F-MANYPASWSSVIQDWYDESLDFVF---GFGPKKVGVKVGHYTQVVW-NSTFL---VACGVAEC 159

  Fly   259 -----SIWIVCNYHPPGN 271
                 ..:.||:|.|.||
  Rat   160 PDQPLKYFYVCHYCPGGN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 40/147 (27%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 37/143 (26%)
Crisp 192..246 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.