DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and crispl

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:221 Identity:57/221 - (25%)
Similarity:91/221 - (41%) Gaps:41/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FPSTPNRSLNTEKDWSHGKRCLQCAAP-----KCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPI 139
            ||..||:   .|..|      :..|||     ...|...:....:|....:|..:....|.|:..
 Frog    39 FPQNPNK---REIAW------IPTAAPFSDYGNDTTQHPAGGSRRKRAGGRKITIPPENIEKMKN 94

  Fly   140 IRRKPI-------KQAVLRETNKYRRLHNANP-----LKM--DEKLCSYAQEWADHLADLNKLE- 189
            :....:       :|::|...|:.||  ||||     |||  .:.....|.:||:.....:.|: 
 Frog    95 VPFSALSTDLESNRQSILNVHNELRR--NANPPPSNMLKMVWSDLAAKSAAKWANSCKQYHSLKP 157

  Fly   190 --TRPNPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKPG--FNLYTGHFTQLVWRESEFLG 250
              |.|....|||:. :...|.|.:.:::.:|.|..::.|.|..  ..|...||||::|..|..:|
 Frog   158 ERTIPGFSCGENLF-MASYKASWEDVIRAFYSEIEDFLYGKGAKEVGLQILHFTQVMWFSSWLVG 221

  Fly   251 VGVA-CDVS----SIWIVCNYHPPGN 271
            ...| |.::    ..:.||:|.|.||
 Frog   222 CAAAQCPITDHSLEFYFVCHYAPAGN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 43/143 (30%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 40/141 (28%)
Crisp 261..314 CDD:369954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.