DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and pi15a

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:213 Identity:57/213 - (26%)
Similarity:85/213 - (39%) Gaps:49/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 CLQCAAPKC---KTSSRSSIQSKKLK----KDKKSLLKEFEIYKIPIIRRKP-IKQ----AVLRE 152
            |:.|.|...   ..::.||:.:..|.    ...|.|.   |...||..|||. |.|    |:|..
Zfish    14 CISCGASALAGFSPTASSSLPATNLTDIGFAPPKYLT---EAANIPKTRRKRYISQNDMLAILDY 75

  Fly   153 TNKYR-----RLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPL---YGENIMRVRRSKF- 208
            .||.|     ...|...:..|:.|...|::||....    .|..|..|   .|:| :.||..:: 
Zfish    76 HNKVRGKVFPPASNMEYMVWDDTLAKTAEQWASTCI----WEHGPRNLLRFLGQN-LSVRTGRYR 135

  Fly   209 SVDQILKLWYQEKYNYDYLKPG----------FNLYTGHFTQLVWRESEFLGVGV-ACDVSSIW- 261
            |:.|::|.|:.|..:|.:..|.          :.....|:||:||..|..:|..: .|...::| 
Zfish   136 SILQLVKPWHDEVKDYSFPYPRDCNPRCPLKCYGPMCTHYTQMVWATSNKVGCAINTCHNMNVWG 200

  Fly   262 --------IVCNYHPPGN 271
                    :||||.|.||
Zfish   201 SVWKRATYLVCNYSPKGN 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 42/159 (26%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 37/147 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.