DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:180 Identity:41/180 - (22%)
Similarity:70/180 - (38%) Gaps:54/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LLKEF--EIYKIPIIRRKPIKQAVLRETNKYRR-----LHNANPLKMDEKLCSYAQEWA------ 179
            |.|.|  ::.::|.|.......|.|...|:.||     ..:.|.:..|:||...|:.|.      
Mouse    22 LPKAFGNDLPRVPSILDPKFIDAFLNIHNELRRKVQPPAADMNQVIWDQKLAKLAKAWTRECKLG 86

  Fly   180 ---------------DHLAD---LNKLETRPNPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDY 226
                           |.:.:   |.::||:|                  :.::..||.|..:|::
Mouse    87 HNPCTSKQYGCLLDYDFIGENIYLGEIETQP------------------EDVVNNWYNENTDYNF 133

  Fly   227 LKPGFNLYTGHFTQLVWRESEFLGVGVA-CD----VSSIWIVCNYHPPGN 271
            :....:....::|||||.::..:|..|: |.    .|:...||||.|.||
Mouse   134 VDNTCSKICRNYTQLVWAKTFKIGCAVSNCPNLTRYSAGLFVCNYSPTGN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 36/160 (23%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 34/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.