DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and PI15

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:202 Identity:55/202 - (27%)
Similarity:81/202 - (40%) Gaps:53/202 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKP-IKQ----AVLRETNKYR-----RLHNANPL 165
            |:.||..:......:.:|..:.:...||..|||. |.|    |:|...|:.|     ...|...:
Human    27 STDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYM 91

  Fly   166 KMDEKLCSYAQEWA-----DHLADLNKLETRPNPLY-----GENIMRVRRSKF-SVDQILKLWYQ 219
            ..||.|...|:.||     ||           .|.|     |:| :.||..:: |:.|::|.||.
Human    92 VWDENLAKSAEAWAATCIWDH-----------GPSYLLRFLGQN-LSVRTGRYRSILQLVKPWYD 144

  Fly   220 EKYNYDYLKPG----------FNLYTGHFTQLVWRESEFLGVGV-ACDVSSIW---------IVC 264
            |..:|.:..|.          |.....|:||:||..|..:|..: .|...::|         :||
Human   145 EVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVC 209

  Fly   265 NYHPPGN 271
            ||.|.||
Human   210 NYAPKGN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 45/166 (27%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 40/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.