DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Ag5r

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:169 Identity:43/169 - (25%)
Similarity:58/169 - (34%) Gaps:65/169 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KQAVLRETNKYRRLHNANPLKMD-EKLCSYAQ-EWADHLADLNKLETRP---------------- 192
            |.|::..||:||. |.|..|..: ...|..|. :|.|.||.|..|..:.                
  Fly    59 KDALVARTNEYRN-HIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMKHDGCHNTDAFDW 122

  Fly   193 -----------NPLYGENIMRVRRSKFSVDQILKLWYQE----------KYNYDYLKPGFNLYTG 236
                       |||...:.:     ::.||    :||.|          .|..:|..|..    |
  Fly   123 SGQNLAWMGYYNPLNVTHYL-----EWGVD----MWYDEAVYTKQAYIDAYPSNYNGPAI----G 174

  Fly   237 HFTQLVW-RESEFLGVGVACDVSSI--------WIVCNY 266
            |||.||. |.:|   ||.|....|:        .:.|||
  Fly   175 HFTVLVADRNTE---VGCAAATYSVSGQSYKAFLLACNY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 43/169 (25%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 43/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.