DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG8483

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:156 Identity:41/156 - (26%)
Similarity:69/156 - (44%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KQAVLRETNKYRRL------------HNANPLKMDEKLCSYAQEWADHLADLNKLETRPNP---- 194
            :..:|:|.|:.|::            .|...:..|::|.:.||:|||:      .:.|.:|    
  Fly    37 RSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADN------CQFRHDPHRTI 95

  Fly   195 ---LYGENIMRV-RRSKFSVD-----QILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLG 250
               ..|:|:..: ..:....|     ..::.|:.|...|.: ...::..|||::||||.|:..:|
  Fly    96 NRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF-GDAWSPKTGHYSQLVWGETSLVG 159

  Fly   251 VGVA--CDVSSI--WIVCNYHPPGNV 272
            .|.|  .|.|..  ..||||.|.|||
  Fly   160 CGYAEYKDTSKYNKLYVCNYGPGGNV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 39/154 (25%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455027
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.