DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG6628

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:81 Identity:21/81 - (25%)
Similarity:29/81 - (35%) Gaps:32/81 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YHNSRNYLA----------------CEVQRS------QSINSIKSLPVKFP------STPNRSLN 89
            :|||...||                |.|:.|      ||||..|....:||      |..|.::.
  Fly   130 FHNSGQNLALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQRFPKGKLGDSIRNFAVM 194

  Fly    90 TEKDWSHGKRCLQCAA 105
            ...:.:|    :.|||
  Fly   195 ARDNNTH----VGCAA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 21/81 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.