DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG43775

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:161 Identity:31/161 - (19%)
Similarity:60/161 - (37%) Gaps:44/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KLKKDKKSLLKEFEIYKIPIIRRKPIKQAVL--RETNKYRRLHNANPLKMDEKLCSYAQEWADHL 182
            |::||..::|..|         |..:....|  .|...:........|:.|.:|...|:..|..:
  Fly    64 KVRKDTLAVLNTF---------RDMLAGGELDTAENKTFPSAKRMRALQWDSELAYMARTHAATV 119

  Fly   183 ADLNKLETRPN---PLYGENIMRVR---RSKFSVDQILKLWY----------QEKYNY------- 224
            :.::. |.|..   ||.|| ::.:.   ..:.|:.::|::.:          |:..::       
  Fly   120 SFMHS-ECRSTLRFPLAGE-VLALSPPVGHRLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSK 182

  Fly   225 -DYLKPGFNLYTGHFTQLVWRESEFLGVGVA 254
             ||       ..|||:.:|......:|.|.|
  Fly   183 RDY-------SVGHFSIIVNDRVSRVGCGFA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 25/135 (19%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 30/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.