DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG17974

DIOPT Version :10

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:130 Identity:34/130 - (26%)
Similarity:47/130 - (36%) Gaps:49/130 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 WADHLADLNKLETRPNPL-------------YGENIMRVRRSKFS-------VDQILKLWYQEKY 222
            |.|.|..|:.|.||...|             .|:|:..|.|.:..       |::.|.||:.|  
  Fly    96 WDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNE-- 158

  Fly   223 NYDYL----------KPGFNLYTGHFTQLVWRESEFLGVGVAC--------DVSSIWI---VCNY 266
             :|.:          .|.|..| |||.:|    |......|.|        |..|::|   :|||
  Fly   159 -FDLIDSSFIDSFKVTPIFEDY-GHFAEL----SVDKNFAVGCSIMRFTRPDYPSVYIYNFICNY 217

  Fly   267  266
              Fly   218  217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 CAP_GAPR1-like 145..272 CDD:349401 34/130 (26%)
CG17974NP_611582.1 CAP_euk 63..218 CDD:349399 34/130 (26%)

Return to query results.
Submit another query.