DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG17575

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001188917.1 Gene:CG17575 / 36414 FlyBaseID:FBgn0250842 Length:298 Species:Drosophila melanogaster


Alignment Length:240 Identity:43/240 - (17%)
Similarity:79/240 - (32%) Gaps:90/240 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 IYKIPIIRRKPIKQAVLRETNKYR------RLHNANP------LKMDEKLCSYAQEWA------- 179
            |.:|...||    ..:|.|.|:||      .|...:|      |:.|::|.|:|:...       
  Fly    56 IVRITTARR----TMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVN 116

  Fly   180 DHLADLNKLET----------------------RPNPLYGENIMRVRRSKFSVDQILKLWYQEKY 222
            ||..:..:...                      .|||   |..:.|  ...:.|:::|...::.:
  Fly   117 DHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNP---EAPIPV--EYHTEDEVIKATLEQMF 176

  Fly   223 -----------------NYDYLKPGFNLYTGHFTQLVWRESEFLGVGV-----------ACDVSS 259
                             |...|:...:....:|||||...:..:|.|:           ...:||
  Fly   177 AEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSS 241

  Fly   260 I--WIVCNYHPPGNVSEHFRENVLPRKFLLLKSDLDAKETRKSKH 302
            :  ::.||:....:|:....::          .|..|.|.|..::
  Fly   242 VHQYMTCNFVRTNDVNAPVYQS----------GDRPATECRSGRN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 34/196 (17%)
CG17575NP_001188917.1 SCP_euk 64..250 CDD:240180 34/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.