DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Clec18a

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_030099497.1 Gene:Clec18a / 353287 MGIID:2672935 Length:615 Species:Mus musculus


Alignment Length:288 Identity:73/288 - (25%)
Similarity:105/288 - (36%) Gaps:83/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DSSNRDLEKCRSCLTSFCRKPIKIYHNSRNYLACEVQRSQSINSIKSLPVKFPSTPNRSLNTEKD 93
            |.||...:     ||:.|        |||:       |....::..||.   |...|..:||   
Mouse    18 DPSNHTWQ-----LTTIC--------NSRS-------RGSDTSTQLSLT---PRLVNSFMNT--- 56

  Fly    94 WSHGKRCLQCAAPKCKTSSRSSIQSK-KLKKDKKS-----LLKEFEIYKI-------PIIRRKPI 145
               |:...|........|.|..||.: .|....:|     ||....:..|       |..::.|.
Mouse    57 ---GRLAGQLREAMSAASGRPMIQPEPSLWLGSQSRWLGLLLLLLSLLGITWTEVQPPQPKQDPT 118

  Fly   146 KQAVLRET--------NKYR-RLH--NANPLKMDEKLCSYAQEWADHLADLNK------------ 187
            .||:.|:.        |:.| |:|  .||..:||         |::.||.|.:            
Mouse   119 LQALSRKESFLILTAHNRLRSRVHPPAANMQRMD---------WSESLAQLAEARAALCVTSVTP 174

  Fly   188 -LETRP--NPLYGENIMRVRRSKFSVDQILKLWYQE--KYNYDYLKPGFNLYTGHFTQLVWRESE 247
             |.:.|  |...|.|:..:.....|..:::.||:.|  :|.:...:...|....|:|||||..|.
Mouse   175 NLASTPGHNSHVGWNVQLMPMGSASFVEVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSS 239

  Fly   248 FLGVG-VACDVSSIWI---VCNYHPPGN 271
            .||.| ..|.|....:   ||.|.|.||
Mouse   240 QLGCGRQPCFVDQEAMEAFVCAYSPGGN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 44/158 (28%)
Clec18aXP_030099497.1 CAP_euk 129..263 CDD:349399 37/142 (26%)
EGF_Lam 315..360 CDD:214543
CLECT 390..514 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.