DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG10651

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:147 Identity:29/147 - (19%)
Similarity:53/147 - (36%) Gaps:42/147 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QSAEKCPLQIIQHNDATFIGC-------DSSNRDLEKC-RSCLTSFCRKPIK-IYHNSRNYLACE 63
            |...|...|::: :.|..:||       .:....|.|| .:|..|.|.:... :|.::....|.|
  Fly   171 QELSKNYFQVLR-DRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASE 234

  Fly    64 VQRSQSINSIKSL-----PVKFPSTPNRSLNTEKDWSHGKRCLQCAAPKCKTSSRSSIQSKKLKK 123
            ..:. |....|:|     .||..:..:..:..|.|::.|                   |.:.::.
  Fly   235 CMKG-SNKQYKNLCHKDELVKTCNGGSLFVEPENDYNDG-------------------QEENMEN 279

  Fly   124 DKKSLLKEFE--IYKIP 138
            |     .|||  ::.:|
  Fly   280 D-----YEFETTVFTLP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455125
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.