DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG4270

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:181 Identity:69/181 - (38%)
Similarity:95/181 - (52%) Gaps:18/181 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 APKCKTSSR-SSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRRLHNANPLKMD 168
            ||..||..| ...:.:..|.:.:..|||                 |...|||||.:|....:.::
  Fly     7 APIPKTHERPPGPRGQDTKGNNELFLKE-----------------VFNTTNKYRAMHGCPAVTIN 54

  Fly   169 EKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKPGFNL 233
            ..|...|||||:||.|.|.:..||||.|||||........:.|..:::||:|..:||:.|..|..
  Fly    55 AALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVP 119

  Fly   234 YTGHFTQLVWRESEFLGVGVACDVSSIWIVCNYHPPGNVSEHFRENVLPRK 284
            ..||||||:|:.|..:|.|||......|:||||:|||||...|::||.|::
  Fly   120 TAGHFTQLIWKSSVEMGSGVARKADRTWVVCNYNPPGNVVGLFKDNVPPKQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 54/125 (43%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 57/143 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451916
Domainoid 1 1.000 77 1.000 Domainoid score I3078
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm3540
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.