DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and glipr2

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:153 Identity:61/153 - (39%)
Similarity:91/153 - (59%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRS---KFSVD 211
            |:..|.||:.|.|.||..::.||..||:||:||.....| ...|..||||:.....|   |.:.:
Zfish    11 LQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTL-AHSNKGYGENLYYAWSSANKKLTGN 74

  Fly   212 QILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVACDVSSIWIVCNYHPPGNVSE-- 274
            :.:..||.|..:|::.:|||:..||||||:||::::.||||:|.|.::|::|..|.|.||::.  
Zfish    75 EAVDSWYGEIKDYNFSRPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFVVGQYLPAGNIANAG 139

  Fly   275 HFRENVLPRKFLLLKSDLDAKET 297
            :|.:||||     ..|.||.|.|
Zfish   140 YFEKNVLP-----TGSKLDQKPT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 50/124 (40%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182 50/124 (40%)
SCP_GAPR-1_like 196..326 CDD:240182
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - mtm6347
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.