DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG31286

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:161 Identity:52/161 - (32%)
Similarity:75/161 - (46%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VLRETNKYRRLHNANPLKMDEKLCSYAQEWADHL---ADLNKLETRPNPLYGENIMRVRRSKFSV 210
            ||||.||.|..|....|.:|..|....|.:|..|   |.||..:. .|..|.|:|.|....:.::
  Fly    32 VLREINKRRDRHGVPKLTLDNVLSKGCQSYAWKLSKSATLNYSDP-TNKDYTESICRFEVKRGAL 95

  Fly   211 DQILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVACDVSSIW--IVCNYHPPGNVS 273
            .:.:|.||..: .:|.|.|    ....||.::||.|..||.|.| :::::.  .|..|.|||||.
  Fly    96 SRCVKNWYNGR-KFDILDP----KAKDFTAMIWRSSVSLGYGDA-NINALQGVFVVRYTPPGNVK 154

  Fly   274 EHFRENVLPRKFLLLKSDLDAKETRKSKHHN 304
            ..:.:||.|||          ::.:|.|..|
  Fly   155 GLYTDNVPPRK----------RKQKKKKREN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 42/127 (33%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 42/127 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455080
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.