DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG32313

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster


Alignment Length:160 Identity:38/160 - (23%)
Similarity:65/160 - (40%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFS 209
            ::..:|...|:.|..:...|:.:||:||:...|:||.:       .|...:|.||.:..   .::
  Fly    23 LRSLILEAHNRRRAKYGNQPMVLDEELCTECSEYADEI-------VRNEGVYTENYLEY---LYA 77

  Fly   210 VDQI-------------------LKLWYQEKYNYDYLKPGF--NLYTGHFTQLVWRESEFLGVGV 253
            .|.|                   :::|:..:        ||  |.....||.::|..|..||||:
  Fly    78 TDPISAKHLQVVCVFREALPRECVRIWFHYR--------GFAENTKYYRFTAMIWNASTRLGVGL 134

  Fly   254 ACDVSSIWIVCNYHPPGNVSEHFRENVLPR 283
            .....:.::|..|.||||:......||..|
  Fly   135 GRIQETRYLVVRYAPPGNILREMASNVPKR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 34/146 (23%)
CG32313NP_001261262.1 SCP 27..153 CDD:294090 34/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.