DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Pi15

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:176 Identity:51/176 - (28%)
Similarity:71/176 - (40%) Gaps:53/176 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IPIIRRKP-IKQ----AVLRETNKYR-----RLHNANPLKMDEKLCSYAQEWA-----DHLADLN 186
            ||..|||. |.|    |:|...|:.|     ...|...:..||.|...|:.||     ||     
  Rat    53 IPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDH----- 112

  Fly   187 KLETRPNPLY-----GENIMRVRRSKF-SVDQILKLWYQEKYNYDYLKPG----------FNLYT 235
                  .|.|     |:| :.||..:: |:.|::|.||.|..:|.:..|.          |....
  Rat   113 ------GPSYLLRFLGQN-LSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMC 170

  Fly   236 GHFTQLVWRESEFLGVGV-ACDVSSIW---------IVCNYHPPGN 271
            .|:||:||..|..:|..: .|...::|         :||||.|.||
  Rat   171 THYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 45/166 (27%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.