DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and F09B9.5

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001024544.1 Gene:F09B9.5 / 259721 WormBaseID:WBGene00008604 Length:184 Species:Caenorhabditis elegans


Alignment Length:184 Identity:56/184 - (30%)
Similarity:80/184 - (43%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IPIIRRKPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIM 201
            ||...::.:.|.:| |.|..|::|:|..|:..|:|...||:|||.||....:........|||| 
 Worm     3 IPEDEKEFVDQMLL-EHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFSELSGIGENI- 65

  Fly   202 RVRRSKFSVD----QILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGVA-------- 254
                :.|..|    .:::.||||...|:|..||:...|.:|||::||.::.:|||.|        
 Worm    66 ----TFFPPDIDAESVVEHWYQEHEKYEYETPGWQTGTNYFTQVIWRSTKEIGVGCAYVRKSHEN 126

  Fly   255 ------CDVSSIW-------------------IVCNYHPPG--NVSEHFRENVL 281
                  |...|:.                   ||..|.|.|  |.|..|..|||
 Worm   127 DEDNTSCSNGSVCKSMTSLSSNGKLAAEGDKVIVAFYRPAGNNNRSGQFASNVL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 48/164 (29%)
F09B9.5NP_001024544.1 CAP_GAPR1-like 9..168 CDD:349401 47/164 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.