DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and D2062.1

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:178 Identity:56/178 - (31%)
Similarity:82/178 - (46%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLAD 184
            |.:.||:.|..    |.||     .:|:.::...|.||..|.|.||..|..:...|:.|||.:|.
 Worm    31 KGQADKQDLAG----YNIP-----KLKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAK 86

  Fly   185 LNKLETRPNPLYGENIMRVRRS------KFSVDQILKLWYQEKYNYDY--LKPGFNLYTGHFTQL 241
            ...:.......||||:....:|      :.....::.|:|.|...|||  .||......|||||:
 Worm    87 SGWISHEKPRKYGENVAMFCQSGCWPLPQTLAQAMVHLFYIEGIGYDYSSFKPELLKENGHFTQI 151

  Fly   242 VWRESEFLGVGVACDVSS--IWIVCNYH-----PPGNV--SEHFRENV 280
            ||:.|..:|||::...||  .:|...:|     |||||  .:::..||
 Worm   152 VWKSSRKIGVGISIGKSSQPPYIPTMFHCVKFDPPGNVLAQQYYLSNV 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 45/140 (32%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 45/142 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161889
Domainoid 1 1.000 68 1.000 Domainoid score I6372
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.