DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and scl-19

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_507654.2 Gene:scl-19 / 191308 WormBaseID:WBGene00013971 Length:207 Species:Caenorhabditis elegans


Alignment Length:156 Identity:42/156 - (26%)
Similarity:71/156 - (45%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KQAVLRETNKYRR-----LHNAN-----PLKMDEKLCSYAQEW----ADHLADLNKLETRPNPL- 195
            :|.||...||.|.     :.:||     |.:..|:| :|.|::    .|::||.      |:.| 
 Worm    23 RQQVLDFHNKLRSQVALGVFSANGTIKPPARNMERL-TYGQQFERLAQDYVADC------PDGLE 80

  Fly   196 --YGENI------MRVRRSKFSVDQ----ILKLWYQEKYNYDYLKPGFN-LYTGHFTQLVWRESE 247
              .|.||      .:|..:..|:|:    .|..|.:|.....:|...:| ......:|:||..::
 Worm    81 IPIGRNIGMNYYTTKVDETYNSMDEYVIDALNDWAEEFQVNGWLSTIYNDTSISAASQMVWAGTK 145

  Fly   248 FLGVGV-ACDVSSIWIVCNYHPPGNV 272
            ::|.|| .||..::.:||.|:..||:
 Worm   146 YVGCGVKRCDPINVVVVCMYYQQGNL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 41/154 (27%)
scl-19NP_507654.2 SCP 21..167 CDD:214553 40/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161866
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.