DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and scl-17

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_493975.1 Gene:scl-17 / 190174 WormBaseID:WBGene00021780 Length:246 Species:Caenorhabditis elegans


Alignment Length:132 Identity:31/132 - (23%)
Similarity:46/132 - (34%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGEN-IMRVRRSKF 208
            |..|.....||..:.|: .||:.....|.    |:.|:          |...|.| :..|....:
 Worm    65 IATAAQNHANKCPKGHD-GPLEGVSGECM----WSGHI----------NASKGVNHLGAVAAKAW 114

  Fly   209 SVDQILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVGV-AC----DVSSIWIVCNYHP 268
            |.:...|.|..:..:.::    ||...||...:.|.....:|.|| .|    |.....:||.|..
 Worm   115 SSEYTKKGWETDVMSDEF----FNSGVGHAIIMTWYSQVNVGCGVKLCQKEGDYQLAIVVCKYWG 175

  Fly   269 PG 270
            .|
 Worm   176 EG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 30/131 (23%)
scl-17NP_493975.1 CAP_euk 25..174 CDD:349399 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161870
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.