DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and F58E2.5

DIOPT Version :10

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:105 Identity:24/105 - (22%)
Similarity:33/105 - (31%) Gaps:36/105 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NDATF--------IGCDSSNRDLEKCRSCLTSFCRKPIKIYHNSRNYLACEVQRSQSINSIKSLP 77
            ||..|        |||..:|     |...:...|....:||.:.:                  .|
 Worm   147 NDDWFKKLISSKSIGCAFNN-----CSENVLFVCYYKEQIYEDFK------------------FP 188

  Fly    78 VKFPSTPNRSLNTEKD----WSHGKRCLQCAAP-KCKTSS 112
            |...:.|.|.:....|    :..||.|..|..| .|:.||
 Worm   189 VNGGAEPGRFIKELDDYVPRYKEGKACSACPPPTSCRGSS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 CAP_GAPR1-like 145..272 CDD:349401
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.