DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and C07A4.2

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_509706.2 Gene:C07A4.2 / 182351 WormBaseID:WBGene00007397 Length:417 Species:Caenorhabditis elegans


Alignment Length:321 Identity:84/321 - (26%)
Similarity:121/321 - (37%) Gaps:88/321 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RSCLTSFC-----------RKPIKIYHNSR--NYLACEVQRSQSINSIKSLPVKFPSTPNRSLNT 90
            |:|.|.||           :..:|::..|.  .|...:|..::|..|:..|.....|....:.:|
 Worm   101 RNCGTGFCINAKIDNEQGEKLFVKVFIGSTVLTYPDYQVLPARSTKSVAILKTNKSSKIRLTYST 165

  Fly    91 EKD-------------WSH--------------------GKRCLQCAAPKCKT-----SSRSSIQ 117
            |.|             ||:                    .|..|:.|:....|     |:..:|:
 Worm   166 ETDDDGTSKTAIEKTHWSNTILRDSRGGALDFFSRLTNQKKYDLKSASVPLDTDVKRLSNIGAIK 230

  Fly   118 S---KKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWA 179
            |   .|.|.||:...:    |.||     .:|:.::...|.||..|.|..|..|..|.|..:.||
 Worm   231 SYLFSKSKVDKQDPAR----YDIP-----KLKEWLVSYHNVYRSKHGAPALISDSVLDSRGKRWA 286

  Fly   180 DHLADLNKLETRPNP-LYGENIMRVRRSKFSVDQ-----ILKLWYQE--KYNYDYLKPGFNLYTG 236
            |.||..........| .||||:...........|     :::.:|.|  .|||...:|.....||
 Worm   287 DELAYHKGCLVHEQPRTYGENLFFFGARHLPSPQTLAAAVIQSFYLEGIGYNYSSWRPMSFFKTG 351

  Fly   237 HFTQLVWRESEFLGVGVA----------CDVSS-----IWIVCNYHPPGNVSEH--FRENV 280
            |||||:|:.|..:||||:          |..||     |::|..|.|.||...|  :..||
 Worm   352 HFTQLIWKNSRKIGVGVSIVKSSSIRSPCVSSSPNMYFIYVVVKYDPAGNFESHKAYLNNV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 48/148 (32%)
C07A4.2NP_509706.2 CAP_GAPR1-like 251..402 CDD:349401 48/150 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161888
Domainoid 1 1.000 68 1.000 Domainoid score I6372
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4761
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.