powered by:
Protein Alignment CG34049 and scl-23
DIOPT Version :9
Sequence 1: | NP_001033871.2 |
Gene: | CG34049 / 3885620 |
FlyBaseID: | FBgn0054049 |
Length: | 306 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499859.3 |
Gene: | scl-23 / 182028 |
WormBaseID: | WBGene00015246 |
Length: | 330 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 17/47 - (36%) |
Similarity: | 24/47 - (51%) |
Gaps: | 10/47 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 236 GHFTQLVWRESEFLGVGV---------ACDVSSIWI-VCNYHPPGNV 272
||.||::|:|:..||..| :.|.....: ||.|:|.|||
Worm 240 GHATQILWKETRKLGCAVQECPARQDGSLDGQKYNVAVCKYYPTGNV 286
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.