DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and vap-1

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:364 Identity:68/364 - (18%)
Similarity:108/364 - (29%) Gaps:141/364 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EIENKVQS-AEKCP--LQIIQ----HNDATFIG-------------------------CDSSNRD 34
            |:|.|.|. |:.||  .|...    .|.||::|                         .|..|:.
 Worm    73 EMEAKAQEWADGCPSSFQTFDPTWGQNYATYMGSIADPLPYASMAVNGWWSEIRTVGLTDPDNKY 137

  Fly    35 LEKCR--------------SCLTSFC--RKPIKIYHNSRNYL----------ACEVQRSQSINSI 73
            .....              .|..:.|  :..|...:|...|:          ||           
 Worm   138 TNSAMFRFANMANGKASAFGCAYALCAGKLSINCIYNKIGYMTNAIIYEKGDAC----------- 191

  Fly    74 KSLPVKFPSTPNRSLNTEKDWSHGKRCLQCAAPK---------CKTSSRSSIQSKK-----LKKD 124
                     |.:....|..| |..|..|...||:         |.:.:..|.|:::     ..|.
 Worm   192 ---------TSDAECTTYSD-SQCKNGLCYKAPQAPVVETFTMCPSVTDQSDQARQNFLDTHNKL 246

  Fly   125 KKSLLKEFEIYKI------PIIRRKP-IKQAVLRETNKYRRLHNANPLKMDEKLCSYAQEWA--- 179
            :.||.|..|...|      |:.::.| :|.:...|.|                    |:.||   
 Worm   247 RTSLAKGLEADGIAAGAFAPMAKQMPKLKYSCTVEAN--------------------ARTWAKGC 291

  Fly   180 --DHLADLNKLETRPNPLYGENIMRVRRSKF----SVDQILKLWYQEKYNYD------YLKPGFN 232
              .|.....:      |..|||:..:..:..    :.:...|.|:.|..::.      ..:..|:
 Worm   292 LYQHSTSAQR------PGLGENLYMISINNMPKIQTAEDSSKAWWSELKDFGVGSDNILTQAVFD 350

  Fly   233 LYTGHFTQLVWRESEFLGVGVACDVSSIWIVCNYHPPGN 271
            ...||:||:.|..:..:|..|....:..:.||.|.|.||
 Worm   351 RGVGHYTQMAWEGTTEIGCFVENCPTFTYSVCQYGPAGN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 28/141 (20%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553 17/101 (17%)
SCP 234..386 CDD:214553 34/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.