DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and vap-2

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:274 Identity:65/274 - (23%)
Similarity:98/274 - (35%) Gaps:84/274 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KIYHNSRNYLACEVQRSQSINSIKSLPVKFPSTPNRSLNTEKD--WSHGKRCLQCAAPKCKTSSR 113
            |.|....:|:.|....|          ..|....|.....||:  :.:||.|  |....|.|...
 Worm   229 KTYRVGCSYIMCGDGES----------ALFTCLYNEKAQCEKEMIYENGKPC--CEDKDCFTYPG 281

  Fly   114 SS-------IQSKKLKKD-------KKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYR-RL---- 159
            |.       .|:..:.||       ..||:.:.            .:...|.:.|.|| ||    
 Worm   282 SKCLVPEGLCQAPSMVKDDGGSFQCDNSLVSDV------------TRNFTLEQHNFYRSRLAKGF 334

  Fly   160 ------HNANP-----LKM--DEKLCSYAQEWADHLADLNKLE-TRPNPLYGENIMRVRRSKFS- 209
                  :.:.|     :||  |..|..:||.||::....:... .|||  .|:|:.   .|.|| 
 Worm   335 EWNGETNTSQPKASQMIKMEYDCMLERFAQNWANNCVFAHSAHYERPN--QGQNLY---MSSFSN 394

  Fly   210 ------VDQILKLWYQEKYNYDYLKPGFNLYT-----------GHFTQLVWRESEFLGVGVACDV 257
                  :...::.|:||...:.  .|..|:.|           ||:||:.|..:..||.|:|...
 Worm   395 PDPRSLIHTAVEKWWQELEEFG--TPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRLGCGIANCP 457

  Fly   258 SSIWIVCNYHPPGN 271
            ...::||:|.|.||
 Worm   458 KMSYVVCHYGPAGN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 44/163 (27%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553 6/33 (18%)
SCP 315..468 CDD:214553 41/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.