DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and scl-13

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_504055.1 Gene:scl-13 / 178798 WormBaseID:WBGene00019179 Length:208 Species:Caenorhabditis elegans


Alignment Length:134 Identity:35/134 - (26%)
Similarity:53/134 - (39%) Gaps:26/134 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 NANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRS-------KFSVDQILKLWY 218
            |...:..||.:.:.|||:|:...|     ......||||:.....|       ||.| .....|.
 Worm    54 NMRKIVWDETVAAAAQEYAEGCPD-----DHSGTSYGENLYWSWSSSAPSSLDKFGV-AASNSWE 112

  Fly   219 QEKYNYDYL-----KPGFNLYTGHFTQLVWRESEFLGVGVA-C-------DVSSIWIVCNYHPPG 270
            .|...|.:.     :.||....||.||:.|.|:..:|.|:. |       ::..:.:||.|...|
 Worm   113 SEFQKYGWTSTFLDEAGFATGIGHATQMAWAETSKIGCGIKNCGKDANKKNMYKVAVVCQYDSAG 177

  Fly   271 NVSE 274
            |:.:
 Worm   178 NMMD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 34/130 (26%)
scl-13NP_504055.1 SCP 21..174 CDD:214553 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.