DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and lon-1

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:145 Identity:43/145 - (29%)
Similarity:68/145 - (46%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IKQAVLRETNKYRRLHNANPLKM---DEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRS 206
            :|:.:..|.|:|||:..|:.:.|   .::|.:.||..|| ..|......|.|  .||||.....|
 Worm    80 LKKWITHEHNRYRRMVPASDMNMLYWSDELAASAQRHAD-TCDFRHSRGRIN--VGENIWAAPYS 141

  Fly   207 KFSVDQILKLWYQEKYNYDYLKP------GFNLYTGHFTQLVWRESEFLGVGVA-C-DVSSIW-- 261
            .:|  ..:.:|:.|.:|     |      .:....||:.|:||.::..:|.|.: | ||..:|  
 Worm   142 NYS--DAISIWFNEVHN-----PRCGCNHAYKHCCGHYVQVVWAKTNLVGCGFSRCRDVQGVWGR 199

  Fly   262 -----IVCNYHPPGN 271
                 .||:|:|.||
 Worm   200 GHRNVFVCHYNPQGN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 43/144 (30%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 40/139 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.