DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CRISP1

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:183 Identity:46/183 - (25%)
Similarity:75/183 - (40%) Gaps:47/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LKKDKKSLLKEFE--IYKIPIIRRKPIKQAVLRETNKYRRLHNA----------NPLKMDEKLCS 173
            |...|||...:|.  :..:|.::.:.:            .:|||          |.|||     |
Human    19 LSMKKKSARDQFNKLVTDLPNVQEEIV------------NIHNALRRRVVPPASNMLKM-----S 66

  Fly   174 YAQEWADH---------LADLNKLETR-PNPLYGENIMRVRRSKFSVDQILKLWYQEKYNY---D 225
            :::|.|.:         :.:.|.||.| ||...||| |.:.....|...::.:||.|..::   :
Human    67 WSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGEN-MHMTSYPVSWSSVIGVWYSESTSFKHGE 130

  Fly   226 YLKPGFNLYTGHFTQLVWRESEFLGVGVA-CDVSS---IWIVCNYHPPGNVSE 274
            :.....::.|.|:||:||..|..:|..:| |....   ...||:|...||..|
Human   131 WTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 38/152 (25%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 37/155 (24%)
Crisp 195..249 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.