DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and GLIPR2

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001273942.1 Gene:GLIPR2 / 152007 HGNCID:18007 Length:169 Species:Homo sapiens


Alignment Length:163 Identity:61/163 - (37%)
Similarity:88/163 - (53%) Gaps:21/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IPIIRRKPIKQ----AVLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNP--- 194
            :.::||||..:    .||:..|:||:.|...|||:.:.|...||::::.||....|:..|..   
Human    12 VSLVRRKPASKQFHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRG 76

  Fly   195 LYGENIMRVRRSKFSVDQ----ILKLWYQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLGVG--V 253
            ..|||:     :..|.||    :...||.|..||::.:|||...|||||.:||:.::.:|||  .
Human    77 QCGENL-----AWASYDQTGKEVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKAS 136

  Fly   254 ACDVSSIWIVCNYHPPGNVSEH--FRENVLPRK 284
            |.|.|| ::|..|.|.|||...  |.|||||.|
Human   137 ASDGSS-FVVARYFPAGNVVNEGFFEENVLPPK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 48/138 (35%)
GLIPR2NP_001273942.1 SCP_GAPR-1_like 23..154 CDD:240182 48/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101367
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.