DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG43777

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:196 Identity:43/196 - (21%)
Similarity:67/196 - (34%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 CKTSSRSSIQSKKLKKDKKSLLKEFEIY-----------------KIPI-----IRRKPIKQAVL 150
            |...:...:..|  ||.....||:|.:|                 ||.:     :|.|.....:.
  Fly    22 CNNKTHKCVLEK--KKHFMCHLKDFTVYGNSTKFHASVPNNMRMQKIALDILNNLRNKFAGGELR 84

  Fly   151 RETNK-YRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPN---PLYGENIMRVR-RSKFSV 210
            .:.|| :.:......|..|::|.......|..|: |...:.|..   |..||.|..|. |.|.::
  Fly    85 TKGNKTFAKARRMRQLFWDKELAYMGNNHASTLS-LKSSQCRSTLRFPHVGEAIALVTPREKLNL 148

  Fly   211 DQI-------LKLWYQEKYNYDYL----KPGFNLYTGHFTQLVWRESEFLGVGVACDVSSIWIVC 264
            .:|       :...||...:.|.|    .|..:....|||.::......:|.|||...:     |
  Fly   149 KEIYSKAFTPMFAEYQHVSDPDALLHAFDPDRDFQVRHFTNIISDRVSRVGCGVAVGAN-----C 208

  Fly   265 N 265
            |
  Fly   209 N 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 31/136 (23%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.