DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and R3HDML

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_848586.1 Gene:R3HDML / 140902 HGNCID:16249 Length:253 Species:Homo sapiens


Alignment Length:171 Identity:46/171 - (26%)
Similarity:70/171 - (40%) Gaps:41/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KIPIIRRKPIKQAVLRETNKYRRLHN----------ANPLKM--DEKLCSYAQEWADHLADLNKL 188
            ::|..|||  :...:|:.|.....||          ||...|  |::|...|:.||......:  
Human    48 EVPRYRRK--RHISVRDMNALLDYHNHIRASVYPPAANMEYMVWDKRLARAAEAWATQCIWAH-- 108

  Fly   189 ETRPNPL---YGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKP-GFNLY---------TGHFTQ 240
              .|:.|   .|:|:........||..::|.|.:||::|.:..| ..|.:         ..|:||
Human   109 --GPSQLMRYVGQNLSIHSGQYRSVVDLMKSWSEEKWHYLFPAPRDCNPHCPWRCDGPTCSHYTQ 171

  Fly   241 LVWRESEFLGVGV-ACDVSSIW---------IVCNYHPPGN 271
            :||..|..||..: .|...|:|         :||||...||
Human   172 MVWASSNRLGCAIHTCSSISVWGNTWHRAAYLVCNYAIKGN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 42/161 (26%)
R3HDMLNP_848586.1 SCP 65..207 CDD:320774 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.