DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and Crisp3

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:176 Identity:49/176 - (27%)
Similarity:80/176 - (45%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRK--PIKQAVLRETNKYRRLHNANPLKMDEKLCS 173
            |..:|::  ||...|||:.:|. :.|...:|||  |....:|.....|....||.. :.|:  |:
Mouse    23 SQENSLE--KLSTSKKSVQEEI-VSKHNQLRRKVSPSGSDLLNMEWNYDAQVNAQQ-RADK--CT 81

  Fly   174 YAQEWADHLADLNKLETRPNPL-YGENIMRVRRSKFSV--DQILKLWYQEKYNYDY-LKPGFNL- 233
            ::.         :.:|.|...| .|||:.   .|.:.|  ..:::.||.|.....: :.|..|: 
Mouse    82 FSH---------SPIELRTTNLKCGENLF---MSSYLVPWSSVIQGWYNESKGLIFGVGPKQNVS 134

  Fly   234 YTGHFTQLVWRESEFLGVGVA-CDVSSI--WIVCNYHPPGNVSEHF 276
            ..||.||:||:.:..:..||| |..:.:  :.||.|.|..|.|.|:
Mouse   135 VVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSGHY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 33/133 (25%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 39/150 (26%)
Crisp 194..241 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.