DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CRISP3

DIOPT Version :10

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:145 Identity:46/145 - (31%)
Similarity:65/145 - (44%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VLRE-TNKYRRLHNA------NPLKMD--EKLCSYAQEWADHLADLNKLETRPNPLY-----GEN 199
            |.|| .||:..|..|      |.|||:  ::..:.||:||:   ..|...:.|....     |||
Human    69 VQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWAN---QCNYRHSNPKDRMTSLKCGEN 130

  Fly   200 IMRVRRSKFSVDQILKLWYQEKYNYDY----LKPGFNLYTGHFTQLVWRESEFLGVGVA-C---D 256
            :.....|. |..|.::.|:.|..::|:    ..|  |...||:||:||..|..:|.|.| |   .
Human   131 LYMSSASS-SWSQAIQSWFDEYNDFDFGVGPKTP--NAVVGHYTQVVWYSSYLVGCGNAYCPNQK 192

  Fly   257 VSSIWIVCNYHPPGN 271
            |...:.||.|.|.||
Human   193 VLKYYYVCQYCPAGN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 CAP_GAPR1-like 145..272 CDD:349401 46/145 (32%)
CRISP3NP_001355052.1 CAP_CRISP 68..205 CDD:349402 43/141 (30%)
Crisp 222..276 CDD:462519
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.