DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and CG42780

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001284979.1 Gene:CG42780 / 10178796 FlyBaseID:FBgn0261848 Length:254 Species:Drosophila melanogaster


Alignment Length:278 Identity:55/278 - (19%)
Similarity:90/278 - (32%) Gaps:103/278 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SCLTSFCRKPIKIYHNSRNYLACEVQRSQSINSIKSLPVKFPSTPNRSLNTEKDWSHGKRCLQCA 104
            |...:|||:  .:......::||     |::|.                      |.|..|    
  Fly    17 SLAENFCRQ--DLCTKGTTHIAC-----QNVNG----------------------SFGSSC---- 48

  Fly   105 APKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIRRKPIKQAVLRETNKYRRLHNANPLKMDE 169
             ||..|..:.::      .||.:|:|..                     |..|:...:...|:..
  Fly    49 -PKDATVIKLNL------GDKNALIKAH---------------------NLVRQKWASGKAKIKW 85

  Fly   170 KLCSYAQ-EWADHLADLNKL----------------ETRPNPLYGENIM-------RVRRSKFSV 210
            ..|..|: ||.   .||.||                .|....|.|:|:.       |:.::|.::
  Fly    86 TACKMAKMEWN---KDLEKLAILNAKTCLMGHDECHNTEKFRLSGQNLFAMGFSHARITKTKMNM 147

  Fly   211 ------DQILKLWYQEKYNY---DYLK--PGFNLYTGHFTQLVWRESEFLGVG-VACDVSSIW-- 261
                  :..::.|..|:.:.   |..|  |......||.|.|:..:|..:|.| ||.::..|.  
  Fly   148 TLSMLFEMAVQKWAGEEKDITAEDLKKTTPNPPEVIGHLTVLINEKSNAVGCGLVAYNLGEIRRY 212

  Fly   262 -IVCNYHPPGNVSEHFRE 278
             :.|||.....:.|...|
  Fly   213 NLACNYAYTNVIGERVYE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 35/164 (21%)
CG42780NP_001284979.1 SCP_euk 62..219 CDD:240180 37/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455119
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.