DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and LOC100536500

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:145 Identity:39/145 - (26%)
Similarity:61/145 - (42%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IKQAVLRETNKYRRL---HNANPLKMDEKLCSYAQEWADHLAD-----LNKLETRPNP------- 194
            ::|.::...|.:||.   ..:|.|||         .|:|.:|:     :||......|       
Zfish    39 VQQEIVDVHNAFRRAVQPSASNMLKM---------SWSDAVAESARGWINKCNMTHGPPSSRMLN 94

  Fly   195 --LYGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKPGFN-LYTGHFTQLVWRESEFLGVGVACD 256
              ..|||:.:..... |...::..|:.|..||.|.....| ..|||:||:||..|..:|..|...
Zfish    95 GYEMGENLFKATGIS-SWTSVVDAWHSEVNNYKYPIGSINGQATGHYTQVVWYSSYEVGCAVTQC 158

  Fly   257 VSSIWIVCNYHPPGN 271
            .|:.:..|:|:..||
Zfish   159 GSNYFYGCHYYRAGN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 39/144 (27%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.