DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34049 and crispld2

DIOPT Version :9

Sequence 1:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:210 Identity:53/210 - (25%)
Similarity:81/210 - (38%) Gaps:59/210 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PIIRRKPI----KQAVLRETNK-----YRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPN 193
            |:..|:.|    ::.:|:..||     |....|...:..|::|...|..||:..    :.|..|.
Zfish    49 PVRTRRAIEWSDREEILKLHNKLRGEVYPTASNMEYMIWDDELERSATSWAEQC----QWEHGPQ 109

  Fly   194 PL---YGENIM----RVRRSKFSVDQILKLWYQEKYNYDYLKP-----------GFNLYTGHFTQ 240
            .|   .|:|:.    |.|...:.|    :.||.|..:|.|..|           ...:.| |:||
Zfish   110 DLLMSIGQNLAVHWGRYRSPAYHV----QAWYDEVKDYTYPYPHECNPWCPERCSGPMCT-HYTQ 169

  Fly   241 LVWRESEFLGVGV-ACDVSSIW---------IVCNYHPPGN-VSEHFRENVLP------------ 282
            |||..:..:|..| .|...::|         :||||.|.|| :.|...::..|            
Zfish   170 LVWATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGRPCSQCPPSYGGVC 234

  Fly   283 RKFLLLKSDLDAKET 297
            |..|..|.|.:.:||
Zfish   235 RDNLCYKRDSERQET 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 42/159 (26%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 38/153 (25%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.